PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ51715.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family GATA
Protein Properties Length: 322aa    MW: 32899 Da    PI: 6.607
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ51715.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.53.9e-18275306132
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrk 32 
                 C+nCg+t+Tp+WR gp+g++tLCnaCG++++k
  KXZ51715.1 275 CRNCGATQTPQWRCGPEGPRTLCNACGVRFKK 306
                 *******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011413.336269305IPR000679Zinc finger, GATA-type
SMARTSM004015.2E-12269318IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.57E-12272312No hitNo description
Gene3DG3DSA:3.30.50.105.4E-14273306IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.00E-13274306No hitNo description
PfamPF003201.2E-15275307IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGSFVPRAIL PLDIHHQLRQ QQLQDALLLA RPAVAFSEHP CTLLRARTSS GDAAATGTKV  60
ACAELSAADG GAQDSAVHPQ PKASACCADG SADDPCEASS AAAVAPAEAV CAQAGAVPAP  120
SSGGEDVSMV CNSHVQAAIQ EAAEPEVASP AAAPPSAVSV GSGDAWEAQP MDVHVPVPAQ  180
RMQELTASAA VPVVGRQALA VPPPAAVAAR SHKRRAAAAA AAAVVKVAAR EDDEDDEDYE  240
EEDDGSAGSR ASKRVKRGGP VRQTAGKLVR GGVTCRNCGA TQTPQWRCGP EGPRTLCNAC  300
GVRFKKGLPL AYMERKKRQM GL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GPJ30.0A0A150GPJ3_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2201430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.12e-12GATA transcription factor 1